PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02220g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 195aa    MW: 20976.5 Da    PI: 8.4066
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02220g00002.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1239.8e-392382362
                    zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                              +++l+cprCdstntkfCyynny+ sqPr+fCk+CrryWt+GG+lr++PvGgg+rkn k+s
  Niben101Scf02220g00002.1 23 SEHLPCPRCDSTNTKFCYYNNYNFSQPRHFCKSCRRYWTHGGTLRDIPVGGGSRKNAKRS 82
                              67899***************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-291980IPR003851Zinc finger, Dof-type
PfamPF027011.5E-332580IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2642680IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102864IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MPSDVSERKA TKQQQGGAPA PESEHLPCPR CDSTNTKFCY YNNYNFSQPR HFCKSCRRYW  60
THGGTLRDIP VGGGSRKNAK RSRTITTNNT SSSTSSCLSS TLSPLDYHHA PTPSHVSPFL  120
VPLTADHHGG PLPFDVKPNG NMCGSFTSLL SNTQGPHGLL ALSGFGLGVG PAIEDMGFGL  180
EAPMAISWSS LSYQC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009779886.11e-115PREDICTED: dof zinc finger protein DOF3.4-like
RefseqXP_016483903.11e-115PREDICTED: dof zinc finger protein DOF3.4-like
TrEMBLM1AMQ12e-98M1AMQ1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000261376e-98(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45322241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66940.14e-38Dof family protein